PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g037710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 398aa    MW: 44614.2 Da    PI: 7.1397
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g037710.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.63.8e-2279138357
                       --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                       +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Sopen03g037710.1  79 SRWNPTPEQLQTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 138
                       7*****************99**************************************97 PP

2Wus_type_Homeobox115.42.8e-3778140365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
   Sopen03g037710.1  78 SSRWNPTPEQLQTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 140
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.5E-576143IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-979138IPR009057Homeodomain-like
SuperFamilySSF466892.31E-1279143IPR009057Homeodomain-like
PfamPF000466.9E-2079138IPR001356Homeobox domain
CDDcd000862.22E-680140No hitNo description
PROSITE profilePS5007111.25684139IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MWMMGYNDGG DFNMTDSFNG RKLRPLMPRV PHAPAATATN PTNCLRNFHG ENFIALNHHQ  60
LAMSEQNKRD FNTQLVVSSR WNPTPEQLQT LEELYRRGTR TPSAEQIQHI TAQLRRYGKI  120
EGKNVFYWFQ NHKARERQKR RRQLESSANG NGNGGGGDDQ SQSNCNAENA ERKESGANRT  180
VFEIEQTKHW PSPTNCSTLA EKTAAKTKAG AAAAAAGATA AGVAESCRVA AAERWIPFDE  240
GEQRRSLLAE RNATWQMMHL SCSPPTINNN NNNTNCATIC SNTITTATCT PIIRSCPSTP  300
TTIDHQTKQL FKPKDHLNIF ITPFRCDQKH QNIIGDEEEE EGNGHEAQTL ELFPLRSSND  360
NNDENNFSDK DEIGAAANLN NNFNGSHYQF FEFLPLKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068191.10.0PREDICTED: WUSCHEL-related homeobox 1
TrEMBLK4BM260.0K4BM26_SOLLC; Uncharacterized protein
STRINGSolyc03g118770.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-50WUSCHEL related homeobox 1